Peptide appearance
Lyophilized form helps protect peptide quality. Peptides are supplied as a dry powder, which may look like a compact "puck" or a lighter powder inside the vial.
Because the peptide is dry, it does not require refrigerated shipping during normal transit, including warm seasonal conditions. For longer storage, follow the storage guidance in the product description.
Appearance can vary. The stated peptide content is checked through third-party analysis.
Read more in the product description.
Solution not bundled
Peptides are delivered as lyophilized powder. This dry form helps preserve peptide quality during storage and transport and does not require refrigerated shipping during normal transit.
To prepare a solution, use a solvent such as Bacteriostatic water. It is sold separately, so add it only when you need it for peptide preparation.
Read more in the product description.
Growth-factor analogue
IGF-1 LR3
Low stock
An engineered long-R3 IGF-1 analogue used in controlled receptor, binding-protein, and recombinant-expression studies.
Order within — · ships Wed, 23 Sep Cutoff 10:00 · local time
Arrives Sep 28 - Sep 30 to Europe
IGF-1 LR3
138,50 €
Long R3 IGF-1 analogue for IGF receptor and binding-protein interaction studies.
Research overview
IGF-1 LR3
IGF-1 LR3 is an engineered analogue of insulin-like growth factor 1 described with an N-terminal extension and an arginine substitution. Published work examines how that design changes its relationship with IGF-binding proteins compared with the parent IGF-1 family.
The cited primary studies use Long R3 IGF-1 in an experimental infusion model and examine recombinant expression of IGF-1 and LR3 IGF-1 constructs. These sources support analogue-level research context but do not prove the construct, folding state, or disulfide arrangement of the supplied material; those properties require exact product and analytical evidence.
Compound information
Specifications
Molecular profile
- Sequence
- MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Molecular mass
- 9117.6 g/mol
- CAS number
- 143045-27-6
- Molecular formula
- C400H625N111O115S9
Material record
- Physical appearance
- White to off-white lyophilized powder
- Solubility
- Soluble in bacteriostatic water and suitable aqueous laboratory solvents.
- Product note
- Long R3 IGF-1 analogue; studied for IGF-1 receptor signalling, IGFBP interaction models, and cell-culture pathway research; supplied strictly for research use only.
Laboratory care
Handling
Peptides in transport
Peptides in lyophilized form are supplied in glass vials by standard shipping methods and do not require refrigeration. Short-term temperature fluctuations during transport will not reduce their quality and efficacy. Even at high summer temperatures, the peptides in lyophilized form are stable for several weeks.
Storage of lyophilized peptides
Lyophilized peptides should be stored in a dry place, protected from light and moisture. The following storage conditions are generally recommended:
- Room temperature (15–25 °C): Up to 3 months
- Refrigerated (2–8 °C): Up to 6 months
- Frozen (-20 °C or below): 3–5 years (recommended for long-term storage)
Allow the vial to reach room temperature after taking it out of the refrigerator or freezer.
Storage of reconstituted peptides
Once reconstituted, peptide solutions are generally less stable than their lyophilized form and should be stored under refrigerated conditions whenever possible.
The following storage conditions are generally recommended:
- Room temperature (15–25 °C): Avoid prolonged storage
- Refrigerated (2–8 °C): Typically 4–8 weeks
- Frozen (-20 °C or below): Up to 3–4 months
To preserve peptide integrity, avoid repeated freeze–thaw cycles, as these may accelerate peptide degradation.
Important: Most manufacturers recommend discarding reconstituted peptides within 4 weeks when stored at 2–8 °C. This recommendation is intentionally conservative and may not reflect the actual chemical stability of every peptide. In our own stability studies, many peptides reconstituted in bacteriostatic water showed no detectable degradation after 12 weeks of refrigerated storage. As peptide stability is highly sequence- and formulation-dependent, this result should not be extrapolated to all peptides without supporting stability data.
Analytical documentation
Tests
Latest published result
Liquilabs s.r.o.Signed Certificate of Analysis · 1mg
98.6%Purity by HPLC
Recorded QC panel
- AssayPeptide screening
- 1.064 mg
- PurityPeptide screening
- 98.6%
- Identity (FTIR)FTIR spectrum
- 994
- Identity (RT)Retention time
- 0.998
These are the latest published results for this strength. The batch number is printed on each vial. Your supplied batch is confirmed against the matching published record when your order is allocated.
Source record
References
Conlon MA, Tomas FM, Owens PC, et al. · 1995
Long R3 insulin-like growth factor-I (IGF-I) infusion stimulates organ growth but reduces plasma IGF-I, IGF-II and IGF binding protein concentrations in the guinea pig
Primary research using Long R3 IGF-I and describing its reduced binding-protein affinity.
Journal of Endocrinology · 10.1677/joe.0.1460247 View source ↗National Center for Biotechnology Information
PubChem Compound Summary: Insulin-like growth factor 1
Authoritative identity record for the parent IGF-1 peptide family.
PubChem · View source ↗Lu Z, Liu N, Huang H, et al. · 2023
Recombinant expression of IGF-1 and LR3 IGF-1 fused with xylanase in Pichia pastoris
Primary expression study including LR3 IGF-1.
Applied Microbiology and Biotechnology · 10.1007/s00253-023-12606-0 View source ↗National Center for Biotechnology Information
PubChem Database
PubChem · View source ↗Mohan S, Baylink DJ · 2002
IGF-binding proteins are multifunctional and act via IGF-dependent and -independent mechanisms
The Journal of endocrinology · View source ↗Tomas FM, Knowles SE, Owens PC, Chandler CS, Francis GL, Read LC, Ballard FJ · 1992
Insulin-like growth factor-I (IGF-I) and especially IGF-I variants are anabolic in dexamethasone-treated rats
The Biochemical journal · View source ↗Tomas FM, Lemmey AB, Read LC, Ballard FJ · 1996
Superior potency of infused IGF-I analogues which bind poorly to IGF-binding proteins is maintained when administered by injection
The Journal of endocrinology · View source ↗von der Thüsen JH, Borensztajn KS, Moimas S, van Heiningen S, Teeling P, van Berkel TJ, Biessen EA · 2011



