Change country: Slovenia
IGF-1 LR3
Peptide appearance Lyophilized form

Growth-factor analogue

IGF-1 LR3

Low stock

An engineered long-R3 IGF-1 analogue used in controlled receptor, binding-protein, and recombinant-expression studies.

Available strengths
138,50 
Bundle & save
Buy in Bulk 10+ units35% off →

Order within · ships Wed, 23 Sep Cutoff 10:00 · local time

Arrives Sep 28 - Sep 30 to Europe

Free shipping on orders over €150
We accept Visa Mastercard Apple Pay (when supported) Google Pay (when supported) More at checkout

IGF-1 LR3

138,50 

Long R3 IGF-1 analogue for IGF receptor and binding-protein interaction studies.

SKU: ADRIA-IGF-1-LR3 Categories: , Tag:

Research overview

IGF-1 LR3

IGF-1 LR3 is an engineered analogue of insulin-like growth factor 1 described with an N-terminal extension and an arginine substitution. Published work examines how that design changes its relationship with IGF-binding proteins compared with the parent IGF-1 family.

The cited primary studies use Long R3 IGF-1 in an experimental infusion model and examine recombinant expression of IGF-1 and LR3 IGF-1 constructs. These sources support analogue-level research context but do not prove the construct, folding state, or disulfide arrangement of the supplied material; those properties require exact product and analytical evidence.

Compound information

Specifications

Molecular profile

Sequence
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Molecular mass
9117.6 g/mol
CAS number
143045-27-6
Molecular formula
C400H625N111O115S9

Material record

Physical appearance
White to off-white lyophilized powder
Solubility
Soluble in bacteriostatic water and suitable aqueous laboratory solvents.
Product note
Long R3 IGF-1 analogue; studied for IGF-1 receptor signalling, IGFBP interaction models, and cell-culture pathway research; supplied strictly for research use only.

Laboratory care

Handling

Peptides in transport

Peptides in lyophilized form are supplied in glass vials by standard shipping methods and do not require refrigeration. Short-term temperature fluctuations during transport will not reduce their quality and efficacy. Even at high summer temperatures, the peptides in lyophilized form are stable for several weeks.

Storage of lyophilized peptides

Lyophilized peptides should be stored in a dry place, protected from light and moisture. The following storage conditions are generally recommended:

  • Room temperature (15–25 °C): Up to 3 months
  • Refrigerated (2–8 °C): Up to 6 months
  • Frozen (-20 °C or below): 3–5 years (recommended for long-term storage)

Allow the vial to reach room temperature after taking it out of the refrigerator or freezer.

Storage of reconstituted peptides

Once reconstituted, peptide solutions are generally less stable than their lyophilized form and should be stored under refrigerated conditions whenever possible.

The following storage conditions are generally recommended:

  • Room temperature (15–25 °C): Avoid prolonged storage
  • Refrigerated (2–8 °C): Typically 4–8 weeks
  • Frozen (-20 °C or below): Up to 3–4 months

To preserve peptide integrity, avoid repeated freeze–thaw cycles, as these may accelerate peptide degradation.

Important: Most manufacturers recommend discarding reconstituted peptides within 4 weeks when stored at 2–8 °C. This recommendation is intentionally conservative and may not reflect the actual chemical stability of every peptide. In our own stability studies, many peptides reconstituted in bacteriostatic water showed no detectable degradation after 12 weeks of refrigerated storage. As peptide stability is highly sequence- and formulation-dependent, this result should not be extrapolated to all peptides without supporting stability data.

Analytical documentation

Tests

Latest published result

Liquilabs s.r.o.Signed Certificate of Analysis · 1mg

98.6%Purity by HPLC

Batch number
20260601
Tested
2026-06-08

Recorded QC panel

AssayPeptide screening
1.064 mg
PurityPeptide screening
98.6%
Identity (FTIR)FTIR spectrum
994
Identity (RT)Retention time
0.998

These are the latest published results for this strength. The batch number is printed on each vial. Your supplied batch is confirmed against the matching published record when your order is allocated.

See all test results

Signed certificate

Source record

References

Conlon MA, Tomas FM, Owens PC, et al. · 1995

Long R3 insulin-like growth factor-I (IGF-I) infusion stimulates organ growth but reduces plasma IGF-I, IGF-II and IGF binding protein concentrations in the guinea pig

Primary research using Long R3 IGF-I and describing its reduced binding-protein affinity.

Journal of Endocrinology · 10.1677/joe.0.1460247 View source ↗

National Center for Biotechnology Information

PubChem Compound Summary: Insulin-like growth factor 1

Authoritative identity record for the parent IGF-1 peptide family.

PubChem · View source ↗

Lu Z, Liu N, Huang H, et al. · 2023

Recombinant expression of IGF-1 and LR3 IGF-1 fused with xylanase in Pichia pastoris

Primary expression study including LR3 IGF-1.

Applied Microbiology and Biotechnology · 10.1007/s00253-023-12606-0 View source ↗

National Center for Biotechnology Information

PubChem Database

PubChem · View source ↗

Mohan S, Baylink DJ · 2002

IGF-binding proteins are multifunctional and act via IGF-dependent and -independent mechanisms

The Journal of endocrinology · View source ↗

Tomas FM, Knowles SE, Owens PC, Chandler CS, Francis GL, Read LC, Ballard FJ · 1992

Insulin-like growth factor-I (IGF-I) and especially IGF-I variants are anabolic in dexamethasone-treated rats

The Biochemical journal · View source ↗

Tomas FM, Lemmey AB, Read LC, Ballard FJ · 1996

Superior potency of infused IGF-I analogues which bind poorly to IGF-binding proteins is maintained when administered by injection

The Journal of endocrinology · View source ↗

von der Thüsen JH, Borensztajn KS, Moimas S, van Heiningen S, Teeling P, van Berkel TJ, Biessen EA · 2011

IGF-1 has plaque-stabilizing effects in atherosclerosis by altering vascular smooth muscle cell phenotype

The American journal of pathology · View source ↗

Customer reviews

4.7/5 from 224 reviews Trustpilot

Efficient and fast order fulfillment, helpful support, and—most importantly—they provide very reliable and comprehensive CoA documentation. That is something that caught my…

Jacek G. Trustpilot

Always fast delivery and super good quality products.

Manuel V. Trustpilot

All good 😊☺️☺️

Goran M. Trustpilot

I’m really impressed with Adria's professionalism and accuracy. Everything arrives exactly as expected—top quality products and consistently fast delivery. Never any worries…

Aive M. Trustpilot

Great conversation, Great product, shiping ver fast. For every recomandation 💪

Nemanja S. Trustpilot

Good service and good product.

Mario M. Trustpilot

The product is realy good

Vuk P. Trustpilot

Proizvod je kvalitetan, dostava brza, korisnička podrška expresno odgovara, omogućuju plaćanje pouzećem. 5/5

vlatka I. Trustpilot

Great, but longer delivery time

moin Trustpilot

Good products, good shipping, sloppy on the updated & constant communication - other then that, very good!

Timothei J. Trustpilot

Ottima qualità e consegna puntualissima

Roberto Trustpilot

Affidabili Seri e con Ottimi Prodotti

Andrea M. Trustpilot